The API built
for bioinformaticians
Run pipelines, search databases, and get AI-powered analysis from your Python scripts — in a single import.
No cloud accounts. No DevOps. No tool installation. GATK, Boltz, SAMtools, and 50+ tools run securely on our infrastructure so you can stay in your scripts.
from smartsbio import SmartsBio
client = SmartsBio(api_key="sk_live_...")
# Predict 3D structure using Boltz-2 — runs on smarts.bio cloud
pipeline = client.pipelines.run(
workspace_id="ws_...",
pipeline_id="protein-structure-prediction",
parameters={
"sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRV",
},
)
for update in pipeline.stream():
print(f"[{update.step}] {update.message}")
result = pipeline.wait()
print(f"Structure saved to: {result.outputs['pdb_file']}")Python · Node.js available →
No setup required
GATK, Boltz, SAMtools, BLAST, and 50+ bioinformatics tools are pre-installed and ready on our cloud. No conda environments, no Docker, no servers to manage.
Secure & isolated
Every job runs in its own isolated environment on our infrastructure. Your sequences, reads, and results never leave smarts.bio — fully GDPR-compliant.
Auto-scaling compute
From a single protein to a genome-wide study — compute scales automatically. No DevOps, no cloud billing surprises, no capacity planning.
Get started in three steps
Get an API Key
Go to Organization Settings → API Keys → Generate key. Your key starts with sk_live_.
Install & run
Install the Python SDK and start calling the API — no other dependencies needed.
pip install smarts-bioWhat you can do
Everything the smarts.bio agent can do — available from your terminal, notebook, or pipeline script.
Run Pipelines
Trigger multi-step bioinformatics pipelines on our cloud and stream real-time progress back to your script.
Ask the Agent
Send natural-language questions and get structured, citation-backed bioinformatics answers.
Search Databases
Query PubMed, GenBank, UniProt, STRING-DB, and Google Patents programmatically — one API, all databases.
Manage Files
Upload, list, download, and organize FASTQ, BAM, VCF, and other files across your workspaces.
Stream Results
Receive agent output and pipeline logs in real time using async generators — no polling required.
Monitor Usage
Track compute hours, pipeline status, and API quota from your code or the dashboard.
What's available out of the box
Every tool, database, and pipeline runs on smarts.bio cloud — nothing to install, nothing to configure.
Bioinformatics Tools
50+ tools, pre-installed
Databases
Query directly, no API keys needed
Predefined Pipelines
Multi-step workflows, one API call
- Quality ControlFastQC → Trimmomatic → FastQC
- Protein StructureBoltz-2 structure prediction
- Variant CallingBWA → SAMtools → GATK HaplotypeCaller
- RNA-seq AnalysisSTAR → featureCounts → DESeq2
- ChIP-seqBowtie2 → SAMtools → MACS2
Documentation & resources
Everything you need to integrate and ship.
Frequently asked questions
Any user on a Pro or higher plan can generate API keys from their Organization Settings. Free plan users have a limited monthly API call quota — more than enough to explore and prototype.
No. GATK, Boltz, SAMtools, BLAST, FastQC, Trimmomatic, and 50+ other tools are pre-installed on smarts.bio cloud infrastructure. You just call the API — we handle all the compute.
Official SDKs are available for Python (pip install smarts-bio) and Node.js/TypeScript (npm install @smartsbio/sdk). The underlying REST API works with any language or tool that can make HTTP requests.
Pass your sk_live_... key as the api_key parameter to the SDK constructor, or include it as an Authorization: Bearer <key> header in raw HTTP requests.
Open your workspace in chat.smarts.bio and go to Workspace Settings — the workspace ID appears at the top of the settings panel.
Ready to automate your workflows?
Generate your API key and start running bioinformatics pipelines from Python — in minutes, with zero cloud setup.