Skip to main content
Python · Node.js · RESTVS CodeVS Code PluginJupyterLabJupyterLab Extension

The API built
for bioinformaticians

Run pipelines, search databases, and get AI-powered analysis from your Python scripts — in a single import.

No cloud accounts. No DevOps. No tool installation. GATK, Boltz, SAMtools, and 50+ tools run securely on our infrastructure so you can stay in your scripts.

example.py
from smartsbio import SmartsBio

client = SmartsBio(api_key="sk_live_...")

# Predict 3D structure using Boltz-2 — runs on smarts.bio cloud
pipeline = client.pipelines.run(
    workspace_id="ws_...",
    pipeline_id="protein-structure-prediction",
    parameters={
        "sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRV",
    },
)

for update in pipeline.stream():
    print(f"[{update.step}] {update.message}")

result = pipeline.wait()
print(f"Structure saved to: {result.outputs['pdb_file']}")

Python · Node.js available →

No setup required

GATK, Boltz, SAMtools, BLAST, and 50+ bioinformatics tools are pre-installed and ready on our cloud. No conda environments, no Docker, no servers to manage.

Secure & isolated

Every job runs in its own isolated environment on our infrastructure. Your sequences, reads, and results never leave smarts.bio — fully GDPR-compliant.

Auto-scaling compute

From a single protein to a genome-wide study — compute scales automatically. No DevOps, no cloud billing surprises, no capacity planning.

Get started in three steps

1

Register

Sign up at chat.smarts.bio. Create an organization and a workspace for your project.

2

Get an API Key

Go to Organization Settings → API Keys → Generate key. Your key starts with sk_live_.

3

Install & run

Install the Python SDK and start calling the API — no other dependencies needed.

pip install smarts-bio

What you can do

Everything the smarts.bio agent can do — available from your terminal, notebook, or pipeline script.

Run Pipelines

Trigger multi-step bioinformatics pipelines on our cloud and stream real-time progress back to your script.

Ask the Agent

Send natural-language questions and get structured, citation-backed bioinformatics answers.

Search Databases

Query PubMed, GenBank, UniProt, STRING-DB, and USPTO programmatically — one API, all databases.

Manage Files

Upload, list, download, and organize FASTQ, BAM, VCF, and other files across your workspaces.

Stream Results

Receive agent output and pipeline logs in real time using async generators — no polling required.

Monitor Usage

Track compute hours, pipeline status, and API quota from your code or the dashboard.

What's available out of the box

Every tool, database, and pipeline runs on smarts.bio cloud — nothing to install, nothing to configure.

Bioinformatics Tools

50+ tools, pre-installed

GATKSAMtoolsFastQCTrimmomaticSTARHISAT2BWABowtie2PicardBoltz-2BCFtoolsBEDtoolsBLASTClustalWMUSCLEDESeq2edgeRkallistoSalmonMACS2HOMERVEPSnpEffFreeBayes+ many more
Available tools →

Databases

Query directly, no API keys needed

PubMedGenBankUniProtSTRING-DBEnsemblPDBNCBI GeneNCBI SRAdbSNPClinVarOMIMRefSeqChEMBLUSPTOAlphaFold DB+ more
Available databases →

Predefined Pipelines

Multi-step workflows, one API call

  • Quality ControlFastQC → Trimmomatic → FastQC
  • Protein StructureBoltz-2 structure prediction
  • Variant CallingBWA → SAMtools → GATK HaplotypeCaller
  • RNA-seq AnalysisSTAR → featureCounts → DESeq2
  • ChIP-seqBowtie2 → SAMtools → MACS2
Predefined pipelines →
VS Code

smarts.bio for VS Code

Run the AI agent, launch pipelines, browse your workspace files, and visualize bioinformatics results — without leaving your editor. Available free on the VS Code Marketplace.

JupyterLab

smarts.bio for JupyterLab

Run the AI agent, launch pipelines, browse your workspace files, and visualize bioinformatics results — without leaving your notebook. Insert AI-generated code directly as a new cell. Available free on PyPI.

Frequently asked questions

Any user on a Pro or higher plan can generate API keys from their Organization Settings. Free plan users have a limited monthly API call quota — more than enough to explore and prototype.

No. GATK, Boltz, SAMtools, BLAST, FastQC, Trimmomatic, and 50+ other tools are pre-installed on smarts.bio cloud infrastructure. You just call the API — we handle all the compute.

Official SDKs are available for Python (pip install smarts-bio) and Node.js/TypeScript (npm install @smartsbio/sdk). The underlying REST API works with any language or tool that can make HTTP requests.

Pass your sk_live_... key as the api_key parameter to the SDK constructor, or include it as an Authorization: Bearer <key> header in raw HTTP requests.

Open your workspace in chat.smarts.bio and go to Workspace Settings — the workspace ID appears at the top of the settings panel.

Ready to automate your workflows?

Generate your API key and start running bioinformatics pipelines from Python — in minutes, with zero cloud setup.